We are here to help   +49 2241 25515 0
  • Shopping Cart Shopping Cart
    0Shopping Cart
  • Products
    • Primary Cells & Culture Media
      • Primary Cells
      • Growth Media
      • Differentiation Media
      • Subculture & Reagents
    • Tissue Dissociation
      • Collagenase & Dispase
      • Papain & Trypsin
      • Elastase & Hyaluronidase
      • Tissue Dissociation Kits
    • Matrix Proteins / Bioprinting
      • Collagen
      • Extracellular Matrix Proteins
      • Tunable Stiffness
      • Adhesion Molecules & Peptides
    • iPSC Research
      • iPSC-derived Cells
      • MEFs
      • Media & Reagents
      • Services & Products
      • iPSC Lines
    • Other Products
      • Enzymes
      • Natural Proteins
      • Staining Kits
      • Cultureware
    • Cell Signaling
      • Cytokines
      • Chemokines
      • Growth Factors
      • Neurotrophins
      • CD Antigens
    • Molecular Biology
      • DNase & Related Products
      • RNase & Related Products
      • Enzymes & Related Products
    • Antibodies
      • Coagulation
      • Immunology
      • Cell Biology
    • Haemostasis & Thrombosis
      • Coagulation Proteins
      • Factor Deficient Plasmas
      • Bone Related Proteins
      • Fluorogenic Substrates & Inhibitors
      • Sample Collection Tubes
  • Services
  • Brands
  • Company
  • Career
  • News
  • Contact
  • Wiki
    • Collagenase Wiki
  • Menu Menu
Home |Products|Cell Signaling|Growth Factors|MIA Human

MIA Human

Cat.-Nr.: CS-C1096

Example image of a clear cryotube with screw cap containing cytokine for research; label is generic

Description

Melanoma Inhibitory Activity Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain consisting of 108 amino having a total molecular mass of 12237 Dalton.
The MIA is purified by proprietary chromatographic techniques.

For other quantities and bulk, please contact us.

  • SUPPLIER:

    CellSystems

  • STATUS:

    In Stock

  • SIZE:

    20 µg

  • Overview

Overview

  • Species: Human
  • Keywords: Growth Factors
  • Product Type: Melanoma Inhibitory Activity
  • Donor / Source:Escherichia Coli.
  • Formulation:The protein was lyophilized from a concentrated (1mg/ml) solution containing 20mM Potassium-phosphate pH=7 and 150mM potassium chloride.
  • Purity:Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
  • Amino acid sequence:Agrees with the sequence of native MIA human with an addition N-terminal Methionine residue. MGPMPKLADRKLCADQECSSHPISMAVALQDYMAPDCRFLTIHRGQVV YVFSLKGRGRFLWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKVDVKT DKWDFYCQ
  • Solubility:It is recommended to reconstitute the lyophilized Melanoma Inhibitory Activity in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
  • Stability:Lyophilized MIA although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIA should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

RELATED PRODUCTS


  • Collagenase Type 2 – CLS-2 (5g)

  • PureCol®, Bovine Collagen

  • Corn Trypsin Inhibitor

  • DermaLife K – Keratinocyte Growth Medium Kit

  • Imprint
  • Privacy policy
Link to: RELM a Mouse Link to: RELM a Mouse RELM a MouseExample image of a clear cryotube with screw cap containing cytokine for research; label is generic Link to: Prolactin Ovine Antagonist Link to: Prolactin Ovine Antagonist Example image of a clear cryotube with screw cap containing cytokine for research; label is genericProlactin Ovine Antagonist
Scroll to top Scroll to top Scroll to top