We are here to help   +49 (0) 2241.255 15 0
  • 0Shopping Cart
  • Product Types
      • Coagulation Proteins
      • Enzymes
      • Cells and Media
      • Cytokines and Chemokines
      • COVID-19 / SARS-CoV-2
      • Molecular Biology
      • Stem Cells / iPSC
      • Adhesion Molecules
      • Tissue Dissociation
      • Matrix Proteins / Bioprinting
      • Gene Editing / CRISPR / TARGATT
  • Brands
  • Company
  • Services
  • Career
  • News
  • Contact
  • Menu Menu
Home |Products|Cytokines and Chemokines|NRG1 Human

NRG1 Human

Cat.-Nr.: CS-C1105

Description

Recombinant Human Neuregulin-1 beta 2 produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 61 amino acids and having a total molecular mass of 7055 Dalton. NRG-1 is purified by proprietary chromatographic techniques.

For other quantities and bulk, please contact us.

  • SUPPLIER:

    CellSystems

  • STATUS:

    In Stock

  • SIZE:

    50 µg

  • Overview

Overview

  • Additional Attributes: Neurotrophins
  • Specific Attributes: Other Neurotrophins
  • Donor / Source:Escherichia Coli.
  • Formulation:Lyophilized from a 0.2 µm filtered solution (0.25mg/ml) in 20mM PB, pH 7.0, containing 0.5%HSA and 2% mannitol.
  • Purity:Greater than 96.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
  • Amino acid sequence:shlvkcaekektfcvnggecfmvkdlsnpsrylckcpneftgdrcqnyvmasfykaeelyq.

RELATED PRODUCTS


  • CLS-2 – Collagenase, Type 2

  • PureCol®, Bovine Collagen

  • Corn Trypsin Inhibitor

  • DermaLife K, Keratinocyte Growth Medium

  • Imprint
  • Privacy policy
IL 4 Porcine M CSF Mouse
Scroll to top