We are here to help   +49 2241 25515 0
  • Products
    • Primary Cells & Culture Media
      • Primary Cells
      • Growth Media
      • Differentiation Media
      • Subculture & Reagents
    • Tissue Dissociation
      • Collagenase & Dispase
      • Papain & Trypsin
      • Elastase & Hyaluronidase
      • Tissue Dissociation Kits
    • Matrix Proteins / Bioprinting
      • Collagen
      • Extracellular Matrix Proteins
      • Tunable Stiffness
      • Adhesion Molecules & Peptides
    • iPSC Research / Gene Editing
      • iPSC-derived Cells
      • MEFs
      • Media & Reagents
      • Services & Products
      • iPSC Lines
    • Other Products
      • Enzymes
      • Natural Proteins
      • Staining Kits
      • Cultureware
    • Cell Signaling
      • Cytokines
      • Chemokines
      • Growth Factors
      • Neurotrophins
      • CD Antigens
    • Molecular Biology
      • DNase & Related Products
      • RNase & Related Products
      • Enzymes & Related Products
    • Antibodies
      • Coagulation
      • Immunology
      • Cell Biology
    • Haemostasis & Thrombosis
      • Coagulation Proteins
      • Factor Deficient Plasmas
      • Bone Related Proteins
      • Fluorogenic Substrates & Inhibitors
      • Sample Collection Tubes
  • Services
  • Wiki
    • Collagenase Wiki
    • Cell Culture Wiki
      • Introduction to Cell Culture
      • Troubleshooting Guide
      • 2D and 3D Cell Culture Approaches
  • Brands
  • Company
  • Career
  • News
  • Contact
  • Menu Menu
Home |Products|Cell Signaling|Chemokines|Eotaxin Human

Eotaxin Human

Cat.-Nr.: CS-C1019

Example image of a clear cryotube with screw cap containing cytokine for research; label is generic

Description

Eotaxin Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 74 amino acids and having a molecular mass of 8345.9 Dalton.
The CCL11 is purified by proprietary chromatographic techniques.

For other quantities and bulk, please contact us.

  • SUPPLIER:

    CellSystems

  • STATUS:

    In Stock

  • SIZE:

    20 µg

  • Overview

Overview

  • Species: Human
  • Keywords: Chemokines
  • Product Type: Eotaxin
  • Donor / Source:Escherichia Coli.
  • Formulation:Lyophilized from a 0.2µm filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 7.4, 150mM NaCl.
  • Purity:Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
  • Amino acid sequence:GPASVPTTCC FNLANRKIPL QRLESYRRIT SGKCPQKAVI FKTKLAKDICADPKKKWVQDSMKYLDQKSP TPK
  • Solubility: It is recommended to reconstitute the lyophilized Eotaxin Human Recombinant in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
  • Stability:Lyophilized Eotaxin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL11 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

RELATED PRODUCTS


  • Collagenase Type 2 – CLS-2 (5g)

  • PureCol®, Bovine Collagen

  • Corn Trypsin Inhibitor

  • DermaLife K – Keratinocyte Growth Medium Kit

  • Imprint
  • Privacy policy
Link to: HCC 1 Human, His Link to: HCC 1 Human, His HCC 1 Human, HisExample image of a clear cryotube with screw cap containing cytokine for research; label is generic Link to: SDF 1 alpha Human Link to: SDF 1 alpha Human Example image of a clear cryotube with screw cap containing cytokine for research; label is genericSDF 1 alpha Human
Scroll to top Scroll to top Scroll to top