We are here to help   +49 2241 25515 0
  • Shopping Cart Shopping Cart
    0Shopping Cart
  • Products
    • Primary Cells & Culture Media
      • Primary Cells
      • Growth Media
      • Differentiation Media
      • Subculture & Reagents
    • Tissue Dissociation
      • Collagenase & Dispase
      • Papain & Trypsin
      • Elastase & Hyaluronidase
      • Tissue Dissociation Kits
    • Matrix Proteins / Bioprinting
      • Collagen
      • Extracellular Matrix Proteins
      • Tunable Stiffness
      • Adhesion Molecules & Peptides
    • iPSC Research
      • iPSC-derived Cells
      • MEFs
      • Media & Reagents
      • Services & Products
      • iPSC Lines
    • Other Products
      • Enzymes
      • Natural Proteins
      • Staining Kits
      • Cultureware
    • Cell Signaling
      • Cytokines
      • Chemokines
      • Growth Factors
      • Neurotrophins
      • CD Antigens
    • Molecular Biology
      • DNase & Related Products
      • RNase & Related Products
      • Enzymes & Related Products
    • Antibodies
      • Coagulation
      • Immunology
      • Cell Biology
    • Haemostasis & Thrombosis
      • Coagulation Proteins
      • Factor Deficient Plasmas
      • Bone Related Proteins
      • Fluorogenic Substrates & Inhibitors
      • Sample Collection Tubes
  • Services
  • Brands
  • Company
  • Career
  • News
  • Contact
  • Wiki
    • Collagenase Wiki
  • Menu Menu
Home |Products|Cell Signaling|Cytokines|LIF Mouse

LIF Mouse

Cat.-Nr.: CS-C2064

Example image of a clear cryotube with screw cap containing cytokine for research; label is generic

Description

Leukemia Inhibitory Factor (LIF) Murine Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a molecular mass of 20 kDa.
The Leukemia Inhibitory Factor (LIF) is purified by proprietary chromatographic techniques.

For other quantities and bulk, please contact us.

  • SUPPLIER:

    CellSystems

  • STATUS:

    In Stock

  • SIZE:

    25 µg

  • Overview

Overview

  • Species: Mouse
  • Keywords: Cytokines
  • Product Type: Leukemia Inhibitory Factor
  • Donor / Source:Escherichia Coli.
  • Formulation:Leukemia Inhibitory Factor (LIF) was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM Phosphate buffer pH-7.4 and 0.02% Tween-20.
  • Purity:Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
  • Amino acid sequence:MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFP NNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNP TAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF
  • Solubility:It is recommended to reconstitute the lyophilized Leukemia Inhibitory Factor (LIF) in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
  • Stability:Lyophilized Leukemia Inhibitory Factor (LIF) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Leukemia Inhibitory Factor (LIF) should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

RELATED PRODUCTS


  • Collagenase Type 2 – CLS-2 (5g)

  • PureCol®, Bovine Collagen

  • Corn Trypsin Inhibitor

  • DermaLife K – Keratinocyte Growth Medium Kit

  • Imprint
  • Privacy policy
Link to: LIF Human Link to: LIF Human LIF HumanExample image of a clear cryotube with screw cap containing cytokine for research; label is generic Link to: IL 11 Mouse Link to: IL 11 Mouse Example image of a clear cryotube with screw cap containing cytokine for research; label is genericIL 11 Mouse
Scroll to top Scroll to top Scroll to top