We are here to help   +49 (0) 2241.255 15 0
  • 0Shopping Cart
  • Product Types
      • Coagulation Proteins
      • Enzymes
      • Cells and Media
      • Cytokines and Chemokines
      • COVID-19 / SARS-CoV-2
      • Molecular Biology
      • Stem Cells / iPSC
      • Adhesion Molecules
      • Tissue Dissociation
      • Matrix Proteins / Bioprinting
      • Gene Editing / CRISPR / TARGATT
  • Brands
  • Company
  • Services
  • Career
  • News
  • Contact
  • Menu Menu
Home |Products|Cytokines and Chemokines|ProNGF Human

ProNGF Human

Cat.-Nr.: CS-C1124

Description

Pro NGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer.Pro-Nerve Growth Factor Human Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 222 amino acids and having a molecular mass of 49,738 Dalton.The Pro NGF is purified by proprietary chromatographic techniques.

For other quantities and bulk, please contact us.

  • SUPPLIER:

    CellSystems

  • STATUS:

    In Stock

  • SIZE:

    10 µg

  • Overview

Overview

  • Additional Attributes: Neurotrophins
  • Specific Attributes: Beta-Nerve Growth Factor
  • Donor / Source:Escherichia Coli.
  • Formulation:The sterile protein solution contains 50mM sodium phosphate buffer pH 7.2, 150mM sodium chloride.
  • Purity:Greater than 98.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
  • Amino acid sequence:MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR.

RELATED PRODUCTS


  • CLS-2 – Collagenase, Type 2

  • PureCol®, Bovine Collagen

  • Corn Trypsin Inhibitor

  • DermaLife K, Keratinocyte Growth Medium

  • Imprint
  • Privacy policy
IL 33 Human BAFF R Human
Scroll to top