We are here to help   +49 2241 25515 0
  • Shopping Cart Shopping Cart
    0Shopping Cart
  • Products
    • Primary Cells & Culture Media
      • Primary Cells
      • Growth Media
      • Differentiation Media
      • Subculture & Reagents
    • Tissue Dissociation
      • Collagenase & Dispase
      • Papain & Trypsin
      • Elastase & Hyaluronidase
      • Tissue Dissociation Kits
    • Matrix Proteins / Bioprinting
      • Collagen
      • Extracellular Matrix Proteins
      • Tunable Stiffness
      • Adhesion Molecules & Peptides
    • iPSC Research
      • iPSC-derived Cells
      • MEFs
      • Media & Reagents
      • Services & Products
      • iPSC Lines
    • Other Products
      • Enzymes
      • Natural Proteins
      • Staining Kits
      • Cultureware
    • Cell Signaling
      • Cytokines
      • Chemokines
      • Growth Factors
      • Neurotrophins
      • CD Antigens
    • Molecular Biology
      • DNase & Related Products
      • RNase & Related Products
      • Enzymes & Related Products
    • Antibodies
      • Coagulation
      • Immunology
      • Cell Biology
    • Haemostasis & Thrombosis
      • Coagulation Proteins
      • Factor Deficient Plasmas
      • Bone Related Proteins
      • Fluorogenic Substrates & Inhibitors
      • Sample Collection Tubes
  • Services
  • Brands
  • Company
  • Career
  • News
  • Contact
  • Wiki
    • Collagenase Wiki
  • Menu Menu
Home |Products|Cell Signaling|Growth Factors|LR3 IGF1 Human

LR3 IGF1 Human

Cat.-Nr.: CS-C1431

Description

The LR3 is a long-term analog of human IGF-1, specifically designed and manufactured for mammalian cell culture to support large-scale manufacturing of recombinant biopharmaceuticals.
Recombinant Human LR3 Insulin Like Growth Factor-1 produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 83 amino acids and having a molecular mass of 9.1kDa.

For other quantities and bulk, please contact us.

  • SUPPLIER:

    CellSystems

  • STATUS:

    In Stock

  • SIZE:

    0.5 mg

  • Overview

Overview

  • Species: Human
  • Keywords: Growth Factors
  • Product Type: Insulin-Like Growth Factor
  • Donor / Source:Escherichia Coli.
  • Formulation:Lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.2.
  • Purity:Greater than 98.0% as determined by SDS-PAGE.
  • Amino acid sequence:MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
  • Solubility:It is recommended to reconstitute the lyophilized LR3 IGF1 in sterile 18M-cm H2O at a concentration of 100µg/ml, which can then be further diluted to other aqueous solutions.
  • Stability:Lyophilized LR3 IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution the LR3 IGF1 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

RELATED PRODUCTS


  • CLS-2 – Collagenase, Type 2

  • PureCol®, Bovine Collagen

  • Corn Trypsin Inhibitor

  • DermaLife K, Keratinocyte Growth Medium Complete Kit

  • Imprint
  • Privacy policy
Link to: FGF23 Human Link to: FGF23 Human FGF23 Human Link to: APOM Human, HEK Link to: APOM Human, HEK APOM Human, HEK
Scroll to top Scroll to top Scroll to top