Overview
- Species: Human
- Keywords: Growth Factors
- Product Type: Insulin-Like Growth Factor
- Donor / Source:Escherichia Coli.
- Formulation:Lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.2.
- Purity:Greater than 98.0% as determined by SDS-PAGE.
- Amino acid sequence:MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
- Solubility:It is recommended to reconstitute the lyophilized LR3 IGF1 in sterile 18M-cm H2O at a concentration of 100µg/ml, which can then be further diluted to other aqueous solutions.
- Stability:Lyophilized LR3 IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution the LR3 IGF1 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
